PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0388s0045.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 280aa    MW: 31025 Da    PI: 7.1433
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0388s0045.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-312376255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH++Fv+a+++LGG+ekAtPk +l++m+v gLt++hvkSHLQ+YR+
  Kalax.0388s0045.1.p 23 PRLRWTPELHSCFVQAIDKLGGQEKATPKLLLQVMDVRGLTISHVKSHLQMYRS 76
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-291977IPR009057Homeodomain-like
PROSITE profilePS5129411.5341979IPR017930Myb domain
SuperFamilySSF466892.87E-152178IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-242377IPR006447Myb domain, plants
PfamPF002492.7E-72475IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MVSCGRGGGA GGGVRQYVRS KVPRLRWTPE LHSCFVQAID KLGGQEKATP KLLLQVMDVR  60
GLTISHVKSH LQMYRSIKSD LSRQVNLNSS DTSKQSFEDH DGDGDADEEQ DDDHNKMTLH  120
HHPSKPTSES DSHFVYNNSV DCINPPKRAR FEMSGSSSVY EEDARVVVHD HRRAGGIIYD  180
TVIISAAGPF SSSSTMLLSQ NPYNRSINAP LGFPVKESNF LQVHATFVAL LSHKKNIFFF  240
SSFFEMGLSV VLALFDPSPH MTELIHIIFH LFGISTHSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651000.13e-52PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLD7SMG82e-51D7SMG8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0137g00050.t014e-51(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.16e-30G2-like family protein